PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy007537
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family GRAS
Protein Properties Length: 584aa    MW: 63926.1 Da    PI: 5.8443
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S59522107PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS410.61.4e-1252175722374
       GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqa 101
                 +lLl+cAeavs+++le a+++L ++s+l++p g++ qR+aayf eA++arl++s+ ++y++lp  + s    +++++a+++f+ +sP++kfsh+taNqa
  Ahy007537 217 LTLLLQCAEAVSAENLEDANKMLLEISQLSTPFGTSAQRVAAYFSEAISARLVSSCLGIYATLPIVPHS----QKVASAFQVFNGISPFVKFSHFTANQA 312
                579***************************************************************996....89999********************** PP

       GRAS 102 IleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEa 201
                I ea+e+eervHiiD+di+qGlQWp L++ LasRp+gpp +R+Tg+g     s e+le+tg+rL++fA++lg+pfef   va+++ ++++e+L+v++ Ea
  Ahy007537 313 IQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGGPPYVRLTGLGT----SMEALEATGKRLSDFANKLGLPFEFFG-VAEKVGNVDPERLNVSKAEA 407
                ************************************************....***************************.7******************* PP

       GRAS 202 laVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvace 301
                +aV++    h+l+d ++s ++    +L+l+++l Pkv++vveq+++ n++sFl rf+ea++yysalfdsl +++++eseer++vE++ll+rei+nv+a  
  Ahy007537 408 VAVHWLQ--HSLYDVTGSDTN----TLWLLQRLAPKVITVVEQDLS-NTGSFLGRFVEAIHYYSALFDSLGSSYGEESEERHVVEQQLLSREIRNVLAVG 500
                ******9..999999999999....*******************97.699************************************************** PP

       GRAS 302 gaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                g +r+ + + +++Wre+l+++GF+ ++l  +aa+qa+lll +++s+gy++ e++g l lgWkd  L+++SaWr
  Ahy007537 501 GPSRTGEPK-FHNWREKLQQCGFRGISLAGNAATQASLLLGMFPSEGYTLVEDNGILKLGWKDLCLLTASAWR 572
                ***998887.**************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.419190552IPR005202Transcription factor GRAS
PfamPF035144.9E-123217572IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 584 aa     Download sequence    Send to blast
XSQSQRNIRN NSANIVEVVT SSPSSMDESS AASNWIDGIL KDLIHSSNSV SIPQLINNVR  60
EIIYPCNPNL AMLLEYRLRL LTSDSSASAV PAAPPPPPPP QNKTPVMKQT NTSNMHAYGA  120
MHFQDSSLNQ YWPVVPPTPL DSNNNNSVSL ANTLPSPPPP PPPPQPPQQE KPEEDLVTAP  180
ATTTSTATAT EMAVLTRKKT EEMNQQKKKD EEGLHLLTLL LQCAEAVSAE NLEDANKMLL  240
EISQLSTPFG TSAQRVAAYF SEAISARLVS SCLGIYATLP IVPHSQKVAS AFQVFNGISP  300
FVKFSHFTAN QAIQEAFERE ERVHIIDLDI MQGLQWPGLF HILASRPGGP PYVRLTGLGT  360
SMEALEATGK RLSDFANKLG LPFEFFGVAE KVGNVDPERL NVSKAEAVAV HWLQHSLYDV  420
TGSDTNTLWL LQRLAPKVIT VVEQDLSNTG SFLGRFVEAI HYYSALFDSL GSSYGEESEE  480
RHVVEQQLLS REIRNVLAVG GPSRTGEPKF HNWREKLQQC GFRGISLAGN AATQASLLLG  540
MFPSEGYTLV EDNGILKLGW KDLCLLTASA WRPPYTTAMA HHHS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-502165724375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016198844.10.0PREDICTED: protein SCARECROW
SwissprotQ9AVK40.0SCR_PEA; Protein SCARECROW
TrEMBLK7MTY80.0K7MTY8_SOYBN; Uncharacterized protein
STRINGGLYMA09G40620.20.0(Glycine max)
STRINGGLYMA18G45220.20.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.10.0GRAS family protein